PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G312900.1.p
Common NameGLYMA_06G312900, LOC100805804
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 515aa    MW: 56769.4 Da    PI: 4.7445
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G312900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-173582148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+ Ed llv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Glyma.06G312900.1.p 35 KGPWTAAEDALLVNYVQKHGEGNWNAVQNYSGLSRCGKSCRLRWANHL 82
                         79******************************************9986 PP

2Myb_DNA-binding49.59.6e-1688131146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g++T+eE+  ++++++++G++ W++ a++++ gRt++++k++w++
  Glyma.06G312900.1.p  88 KGAFTAEEERMIAELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 131
                          799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1293082IPR017930Myb domain
SMARTSM007173.7E-153484IPR001005SANT/Myb domain
SuperFamilySSF466897.49E-3134129IPR009057Homeodomain-like
PfamPF002496.6E-163582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-233689IPR009057Homeodomain-like
CDDcd001672.20E-113782No hitNo description
PROSITE profilePS5129424.11783137IPR017930Myb domain
SMARTSM007173.8E-1687135IPR001005SANT/Myb domain
PfamPF002498.4E-1588131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2590136IPR009057Homeodomain-like
CDDcd001671.43E-1190131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MSQMTNEVDN NVHYDDQTGS QLNDDGNGVG VVLKKGPWTA AEDALLVNYV QKHGEGNWNA  60
VQNYSGLSRC GKSCRLRWAN HLRPNLKKGA FTAEEERMIA ELHAKMGNKW ARMAAHLPGR  120
TDNEIKNYWN TRMKRRRRAG LPLYPPEVLL QAFQERKHGQ GTGEISDGDG GHRDFLKKNN  180
YEIHDAIFDS LKENQGILPF LPDLPAISAN SFLPNGLGSP PYCNLLPSTL PNHDHLQEST  240
MSFIGSSELN SNRFYPFDHI KDNTSDKISE SFGLYSPLDR GVSHGSICYS HSLSNGNSST  300
SKPTSEAVKS ELPSLQIPET EFGSWGTSPP PPLNESLDVF IHSPQPPNAL DSGSSSPLNS  360
GLLDALLYQA NTLGCSKNNS SDKSSNSSIA TPGDRAECSA LNMYETEWED YADPLSPFGA  420
TSILNEHPVV STNGNSWDEW ELFQTFSENS AGNNERLQSI DQVWTPKSEN QSMSLLNFTL  480
PDVLITSDWH ELYSDHDSTN QAIMTEASDD ISGQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-30321361104C-Myb DNA-Binding Domain
1msf_C1e-30321361104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1871650.0AC187165.17 Glycine max cultivar Williams 82 clone gmw2-91b16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006582387.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLK7KYG30.0K7KYG3_SOYBN; Uncharacterized protein
STRINGGLYMA06G47000.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.19e-92myb domain protein 65